MYD118 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58997

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-58997
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all MYD118 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GADD45B(growth arrest and DNA-damage-inducible, beta) The peptide sequence was selected from the middle region of GADD45B. Peptide sequence FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MYD118 Antibody

Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997] - Fetal Lung lysates, Antibody Dilution: 3.0 ug/ml.
Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997]

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B
Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997]

Western Blot: MYD118 Antibody [NBP1-58997] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
View 2 more images

Applications for MYD118 Antibody

Application
Recommended Usage

Immunohistochemistry

2ug/mL

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYD118

The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

DKFZp566B133, GADD45BETA, growth arrest and DNA damage-inducible protein GADD45 beta, growth arrest and DNA-damage-inducible, beta, MYD118DKFZP566B133, Myeloid differentiation primary response protein MyD118, Negative growth regulatory protein MyD118

Gene Symbol

GADD45B

UniProt

O75293 (Human)

Additional MYD118 Products

Product Documents for MYD118 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MYD118 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.