Myoferlin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59396

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59396
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Myoferlin Antibodies »

Product Summary for Myoferlin Antibody

Immunogen

Synthetic peptides corresponding to FER1L3(fer-1-like 3, myoferlin (C. elegans)) The peptide sequence was selected from the C terminal of FER1L3. Peptide sequence QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Myoferlin Antibody

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
View 5 more images

Applications for Myoferlin Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myoferlin

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined.

Alternate Names

fer-1 (C.elegans)-like 3 (myoferlin), FER1L3, fer-1-like 3, myoferlin, fer-1-like 3, myoferlin (C. elegans), Fer-1-like protein 3, FLJ36571, FLJ90777, KIAA1207, myoferlin

Gene Symbol

MYOF

UniProt

Q9NZM1 (Human)

Additional Myoferlin Products

Product Documents for Myoferlin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Myoferlin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.