n-Myc Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-95112

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-95112-0.1ml
NBP2-95112-0.02ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all n-Myc Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human n-Myc (NP_005369.2). AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for n-Myc Antibody - BSA Free

Western Blot: n-Myc AntibodyBSA Free [NBP2-95112]

Western Blot: n-Myc AntibodyBSA Free [NBP2-95112]

Western Blot: n-Myc Antibody [NBP2-95112] - Analysis of extracts of HeLa cells, using MYCN antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: n-Myc Antibody - BSA Free [NBP2-95112]

Immunocytochemistry/ Immunofluorescence: n-Myc Antibody - BSA Free [NBP2-95112]

Immunocytochemistry/Immunofluorescence: n-Myc Antibody [NBP2-95112] - Analysis of mouse brain using MYCN Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry: n-Myc Antibody [NBP2-95112] - Analysis of rat brain using MYCN Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
View 2 more images

Applications for n-Myc Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:100 - 1:500
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: n-Myc

n-Myc is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas.

Alternate Names

BHLHE37, bHLHe37N-myc proto-oncogene protein, Class E basic helix-loop-helix protein 37, MODED, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, N-myc, NMYCneuroblastoma MYC oncogene, ODED, oncogene NMYC, pp65/67, v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived, v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)

Gene Symbol

MYCN

Additional n-Myc Products

Product Documents for n-Myc Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for n-Myc Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.