NALP12 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87879

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87879
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all NALP12 Antibodies »

Product Summary for NALP12 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NALP12. Peptide sequence: LEVSLVTPRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NALP12 Antibody

Western Blot: NALP12 Antibody [NBP2-87879]

Western Blot: NALP12 Antibody [NBP2-87879]

Western Blot: NALP12 Antibody [NBP2-87879] - Host: Rabbit. Target Name: NLRP12. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NALP12 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NALP12

NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP12, have an N-terminal pyrin (MEFV; MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1; MIM 147678) via their involvement in multiprotein complexes called inflammasomes. NALP12 may mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Alternate Names

FCAS2, Monarch-1, NACHT, leucine rich repeat and PYD containing 12, NACHT, LRR and PYD domains-containing protein 12, NALP12LRR and PYD containing protein 12, NLR family, pyrin domain containing 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12, PYPAF7Monarch1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide, RNO2

Gene Symbol

NLRP12

Additional NALP12 Products

Product Documents for NALP12 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NALP12 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.