NDUFA9 Antibody (3D7)

Novus Biologicals, part of Bio-Techne | Catalog # H00004704-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00004704-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3D7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all NDUFA9 Antibodies »

Product Specifications

Immunogen

NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

NDUFA9 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for NDUFA9 Antibody (3D7)

Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01]

Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01]

Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7 Analysis of NDUFA9 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01]

Immunocytochemistry/ Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01]

Immunocytochemistry/Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01]

Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01]

Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.8 ug/ml.
View 3 more images

Applications for NDUFA9 Antibody (3D7)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NDUFA9

ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.

Alternate Names

CC6, CI39k, CI-39k, CI-39kD, complex I 39kDa subunit, Complex I-39kD, MGC111043, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase), NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L, SDR22E1, short chain dehydrogenase/reductase family 22E, member 1

Entrez Gene IDs

4704 (Human)

Gene Symbol

NDUFA9

OMIM

603834 (Human)

UniProt

NP_004993 (Human)

Additional NDUFA9 Products

Product Documents for NDUFA9 Antibody (3D7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NDUFA9 Antibody (3D7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.