NDUFB4 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03538

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03538-100ul
NBP3-03538-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all NDUFB4 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFB4 Antibody - Azide and BSA Free

Western Blot: NDUFB4 AntibodyAzide and BSA Free [NBP3-03538]

Western Blot: NDUFB4 AntibodyAzide and BSA Free [NBP3-03538]

Western Blot: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts of various cell lines, using NDUFB4 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of U-2 OS cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
View 4 more images

Applications for NDUFB4 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFB4

The NDUFB4 gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electr

Alternate Names

B15, CI-B15, complex I B15 subunit, Complex I-B15, MGC5105, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4 (15kD, B15), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, NADH-ubiquinone oxidoreductase B15 subunit

Gene Symbol

NDUFB4

Additional NDUFB4 Products

Product Documents for NDUFB4 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NDUFB4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.