Neutrophil Elastase/ELA2 Antibody (8X4E6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16724

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16724-100ul
NBP3-16724-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8X4E6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Neutrophil Elastase/ELA2 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246). SVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Neutrophil Elastase/ELA2 Antibody (8X4E6)

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Western Blot: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724] - Analysis of extracts of various cell lines, using Neutrophil Elastase/ELA2 antibody (NBP3-16724) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724] - Analysis of human spleen using Neutrophil Elastase/ELA2 Rabbit mAb (NBP3-16724) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Immunohistochemistry-Paraffin: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724]

Immunohistochemistry-Paraffin: Neutrophil Elastase/ELA2 Antibody (8X4E6) [NBP3-16724] - Mouse bone marrow using Neutrophil Elastase/ELA2 antibody (NBP3-16724) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Neutrophil Elastase/ELA2 Antibody (8X4E6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Neutrophil Elastase/ELA2

The ELANE gene (commonly known as neutrophil elastase) encodes a 267 amino acid long, 28 kDA neutrophil elastase protein that functions in regulation of natural killer cells, monocytes, and graulocytes. ELANE is involved in activation of proMMP8, cell adhesion cell-matrix glycoconjugates, selected targets of C/EBPbeta, degradation of the extracellular matrix and collagen, and amb2 integrin signaling. It interacts with various genes GZMB, LRP1, SERPINF2, SERPING1, and SERPINA1. Elane has been linked to cystic fibrosis, asthma, pneumonia, alzheimer's disease, neutropenia, cutis laxia, leg ulcers, wegener's granulomatosis, bronchitis, adult respiratory distress syndrome, and vascular diseases.

Alternate Names

ELA2, ELANE, Elastase-2, Leukocyte Elastase, Medullasin

Gene Symbol

ELANE

Additional Neutrophil Elastase/ELA2 Products

Product Documents for Neutrophil Elastase/ELA2 Antibody (8X4E6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Neutrophil Elastase/ELA2 Antibody (8X4E6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.