NFkB p100/p52 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-93391

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-93391-0.02ml
NBP2-93391-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all NFkB p100/p52 Antibodies »

Product Summary for NFkB p100/p52 Antibody - Azide and BSA Free

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human NFkB p100/p52 (NP_001070962.1). GGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NFkB p100/p52 Antibody - Azide and BSA Free

Western Blot: NFkB p100/p52 AntibodyAzide and BSA Free [NBP2-93391]

Western Blot: NFkB p100/p52 AntibodyAzide and BSA Free [NBP2-93391]

Western Blot: NFkB p100/p52 Antibody [NBP2-93391] - Analysis of extracts of various cell lines, using NFkB p100/p52 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Applications for NFkB p100/p52 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NFkB p100/p52

The NFkappaB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The DNA binding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkappaB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkappaB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.

Alternate Names

DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52

Gene Symbol

NFKB2

Additional NFkB p100/p52 Products

Product Documents for NFkB p100/p52 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NFkB p100/p52 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.