Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87918

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87918
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Nicotinic Acetylcholine R alpha 3/CHRNA3. Peptide sequence: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918] - Host: Rabbit. Target Name: CHRNA3. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml
Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918] - WB Suggested Anti-CHRNA3 Antibody Titration: 0.1ug/ml. Positive Control: Human Thymus
Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918]

Western Blot: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP2-87918] - Host: Rat. Target Name: CHRNA3. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml

Applications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 3/CHRNA3

The nicotinic acetylcholine receptor (nAChR) is a ligand gated ion channel that mediates neurotransmission at the neuromuscular junction, autonomic ganglia and at some sites in the central nervous system. Distinct nAChR subtypes exist that can be stimulated by the neurotransmitter acetylcholine, the natural product nicotine, or by synthetic compounds. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 responds by an extensive change in conformation that affects all subunits and leads to opening of an ion conducting channel across the plasma membrane.

Long Name

Nicotinic Acetylcholine Receptor alpha 3

Alternate Names

CHRNA3, LNCR2, NACHRA3, Nicotinic Acetylcholine Ra3, PAOD2

Gene Symbol

CHRNA3

Additional Nicotinic Acetylcholine R alpha 3/CHRNA3 Products

Product Documents for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.