Nicotinic Acetylcholine Receptor beta 2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82291

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82291-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

View all Nicotinic Acetylcholine R beta 2/CHRNB2 Antibodies »

Product Summary for Nicotinic Acetylcholine Receptor beta 2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Nicotinic Acetylcholine Receptor beta 2. Peptide sequence: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nicotinic Acetylcholine Receptor beta 2 Antibody

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291] - WB Suggested Anti-CHRNB2 Antibody. Titration: 1.25 ug/ml. Positive Control: HepG2 Whole Cell
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291] - Host: Mouse. Target Name: CHRNB2. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291] - Host: Rabbit. Target Name: CHRNB2. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 3ug/ml

Applications for Nicotinic Acetylcholine Receptor beta 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R beta 2/CHRNB2

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. After binding Acetylcholine, the Nicotinic Acetylcholine Receptor (AChR) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Neuronal AChR seems to be composed of two different type of subunits: alpha and beta.

Long Name

Nicotinic Acetylcholine Receptor beta 2

Alternate Names

Cholinergic Receptor Nicotinic Beta 2 Subunit, CHRNB2, EFNL3, NAChRB2, Neuronal Nicotinic Acetylcholine R beta 2

Gene Symbol

CHRNB2

Additional Nicotinic Acetylcholine R beta 2/CHRNB2 Products

Product Documents for Nicotinic Acetylcholine Receptor beta 2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine Receptor beta 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.