Nicotinic Acetylcholine Receptor beta 2 Antibody
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82291
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Concentration
1 mg/ml
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human Nicotinic Acetylcholine Receptor beta 2. Peptide sequence: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Nicotinic Acetylcholine Receptor beta 2 Antibody
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291] - WB Suggested Anti-CHRNB2 Antibody. Titration: 1.25 ug/ml. Positive Control: HepG2 Whole CellWestern Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291] - Host: Mouse. Target Name: CHRNB2. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/mlWestern Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291]
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82291] - Host: Rabbit. Target Name: CHRNB2. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 3ug/mlApplications for Nicotinic Acetylcholine Receptor beta 2 Antibody
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Nicotinic Acetylcholine R beta 2/CHRNB2
Long Name
Nicotinic Acetylcholine Receptor beta 2
Alternate Names
Cholinergic Receptor Nicotinic Beta 2 Subunit, CHRNB2, EFNL3, NAChRB2, Neuronal Nicotinic Acetylcholine R beta 2
Gene Symbol
CHRNB2
Additional Nicotinic Acetylcholine R beta 2/CHRNB2 Products
- All Products for Nicotinic Acetylcholine R beta 2/CHRNB2
- Nicotinic Acetylcholine R beta 2/CHRNB2 cDNA Clones
- Nicotinic Acetylcholine R beta 2/CHRNB2 ELISA Kits
- Nicotinic Acetylcholine R beta 2/CHRNB2 Lysates
- Nicotinic Acetylcholine R beta 2/CHRNB2 Primary Antibodies
- Nicotinic Acetylcholine R beta 2/CHRNB2 Proteins and Enzymes
Product Documents for Nicotinic Acetylcholine Receptor beta 2 Antibody
Product Specific Notices for Nicotinic Acetylcholine Receptor beta 2 Antibody
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...