NKIRAS1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-93958

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-93958-0.02ml
NBP2-93958-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all NKIRAS1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1). LGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NKIRAS1 Antibody - Azide and BSA Free

Western Blot: NKIRAS1 AntibodyAzide and BSA Free [NBP2-93958]

Western Blot: NKIRAS1 AntibodyAzide and BSA Free [NBP2-93958]

Western Blot: NKIRAS1 Antibody [NBP2-93958] - Analysis of extracts of various cell lines, using NKIRAS1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: NKIRAS1 Antibody - Azide and BSA Free [NBP2-93958]

Immunocytochemistry/ Immunofluorescence: NKIRAS1 Antibody - Azide and BSA Free [NBP2-93958]

Immunocytochemistry/Immunofluorescence: NKIRAS1 Antibody [NBP2-93958] - Immunofluorescence analysis of PC-12 cells using NKIRAS1 Rabbit pAb (NBP2-93958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: NKIRAS1 Antibody - Azide and BSA Free [NBP2-93958]

Immunocytochemistry/ Immunofluorescence: NKIRAS1 Antibody - Azide and BSA Free [NBP2-93958]

Immunocytochemistry/Immunofluorescence: NKIRAS1 Antibody [NBP2-93958] - Immunofluorescence analysis of NIH/3T3 cells using NKIRAS1 Rabbit pAb (NBP2-93958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for NKIRAS1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NKIRAS1

NF-kB is silenced in the cytoplasm by an inhibitory protein, IkB. Synthesis of IkBa is autoregulated. IkB proteins are phosphorylated by IkB kinase complex consisting of at least three proteins, IKK1/a, IKK2/b, and IKK3/g. External stimuli such as tumor necrosis factor or other cytokines results in phosphorylation and degradation of IkB releasing NF-kB dimers. NF-kB dimer subsequently translocates to the nucleus and activates target genes. Six members of IkB family members have been identified. One of the first genes induced following NF-kB activation is IkBa. Recently, two proteins, kB-Ras1 and kB-Ras2 have been identified. These two proteins interact with PEST domains of IkBa and IkBb and decrease their rate of degradation.

Alternate Names

I-kappa-B-interacting Ras-like protein 1, kappa B-ras 1, Kappa B-Ras protein 1, KappaB-Ras1, KBRAS1kappaB-Ras1, NF-kappa-B inhibitor-interacting Ras-like protein 1, NFKB inhibitor interacting Ras-like 1, NFKB inhibitor interacting Ras-like protein 1

Gene Symbol

NKIRAS1

Additional NKIRAS1 Products

Product Documents for NKIRAS1 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NKIRAS1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.