nkx6.2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09184

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09184-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all nkx6.2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human nkx6.2 (NP_796374). Peptide sequence PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for nkx6.2 Antibody

Western Blot: nkx6.2 Antibody [NBP3-09184]

Western Blot: nkx6.2 Antibody [NBP3-09184]

Western Blot: nkx6.2 Antibody [NBP3-09184] - Western blot analysis of nkx6.2 in Esophagus Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for nkx6.2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: nkx6.2

Nkx6.2, also known as Homeobox Protein Nkx-6.2, consists of a 277 amino acid isoform that is 29 kDa, and is located within the nucleus of brain cells, though its specific function is unknown. Research is currently being conducted on Nkx6.2 and its relation to a variety of diseases and disorders, including chronic myocardial ischemia, hermaphroditism, and neuronitis. The protein is linked to the regulation of transcription and cell fate commitment, and is not known to interact with any other proteins.

Alternate Names

GTXhomeobox 6B, Homeobox protein NK-6 homolog B, homeobox protein Nkx-6.2, MGC126684, NK homeobox family 6, B, NK6 homeobox 2, NK6 transcription factor related, locus 2, NK6 transcription factor related, locus 2 (Drosophila), NKX6.1, NKX6.2, NKX6Bglial and testis-specific homeobox protein

Gene Symbol

NKX6-2

Additional nkx6.2 Products

Product Documents for nkx6.2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for nkx6.2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.