NTAN1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84192

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84192-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all NTAN1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NTAN1. Peptide sequence: EPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKISSPG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NTAN1 Antibody

Western Blot: NTAN1 Antibody [NBP2-84192]

Western Blot: NTAN1 Antibody [NBP2-84192]

Western Blot: NTAN1 Antibody [NBP2-84192] - Host: Rabbit. Target Name: NTAN1. Sample Tissue: Human Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for NTAN1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NTAN1

MECA-79 recognizes a carbohydrate epitope shared with a group of sulfation decorated sialomucins, including sulfated ligands for CD62L (CD34, GlyCAM-1, Sgp200, and a subset of MAdCAM-1). This set antigens has been referred to as peripheral node addressin (PNAd) with the molecular mass 50-250 kD. It has been identified that GlcNAc-6-SO4 sulfation contributes to MECA-79 binding and the core 1 beta1,3-N-acetylglucosaminyltransferase is required for the generation of the MECA-79 epitope. MECA-79 is expressed on high endothelial venules (HEV) of lymphoid tissues, chronic inflamed tissues and rheumatoid synovia. The interaction of PNAd with CD62L receptor is involved in tethering and rolling of lymphocytes along HEV in lymphoid tissues. MECA-79 antibody reacts with mouse, human and many other species PNAd and blocks L-selectin-dependent lymphocyte adhesion in vitro and in vivo.

Alternate Names

DKFZp666E058, EC 3.5.1.-, N-terminal asparagine amidase, N-terminal asparagine amidohydrolase, PNAA, PNAD, Protein NH2-terminal asparagine amidohydrolase, Protein NH2-terminal asparagine deamidase, Protein N-terminal Asn amidase, protein N-terminal asparagine amidohydrolase, Protein NTN-amidase

Gene Symbol

NTAN1

Additional NTAN1 Products

Product Documents for NTAN1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NTAN1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.