O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16203

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16203-100ul
NBP3-16203-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Chromatin Immunoprecipitation (ChIP), Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3Q9B8

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all O-GlcNAc Transferase/OGT Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 947-1046 of human O-GlcNAc Transferase p110 subunit (O15294). PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]

Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]

Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] - Western blot analysis of extracts of various cell lines, using O-GlcNAc Transferase p110 subunit Rabbit mAb (NBP3-16203) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]

Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]

Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug O-GlcNAc Transferase p110 subunit antibody (NBP3-16203). Western blot was performed from the immunoprecipitate using O-GlcNAc Transferase p110 subunit antibody (NBP3-16203) at a dilition of 1:1000.

Applications for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

1:500 - 1:1000

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: O-GlcNAc Transferase/OGT

Diffusion of metabolites and small non-nuclear molecules as well as active, mediated import of protein and export of protein and RNA through the nuclear envelope occurs through nuclear pore complexes or NPC's. NPC's contain up to 100 different polypeptides which have a combined mass of about 125 megadaltons. The channel available for passive transport through the NPC is about 9-10 nm in diameter while carrier mediated changes in the NPC result in a ~25 nm channel used for larger, actively transported molecules. Of the 100 polypeptides, at least 8 of these are O-linked N-acetylglycosamine-modified in mammalian cells. All of the mammalian O-linked glycoproteins contain multiple copies of phenylalanine, glycine dipeptide repeats dispersed throughout part of their sequence. Studies indicate that the NPC O-linked glycoproteins have a direct role in nuclear protein import.

Long Name

O-Linked N-Acetylglucosamine (GlcNAc) Transferase

Alternate Names

HRNT1, OGlcNAc Transferase, OGT

Gene Symbol

OGT

Additional O-GlcNAc Transferase/OGT Products

Product Documents for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.