OCA2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-60052

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-60052
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all OCA2 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OCA2(oculocutaneous albinism II) The peptide sequence was selected from the middle region of OCA2. Peptide sequence LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OCA2 Antibody

Western Blot: OCA2 Antibody [NBP1-60052]

Western Blot: OCA2 Antibody [NBP1-60052]

Western Blot: OCA2 Antibody [NBP1-60052] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for OCA2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OCA2

OCA2 is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in the gene encoding OCA2 result in type 2 oculocutaneous albinism.This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

BEY, BEY1, BEY2, D15S12BOCA, EYCL, EYCL2, eye color 2 (central brown), eye color 3 (brown), hair color 3 (brown), HCL3, Melanocyte-specific transporter protein, oculocutaneous albinism II, oculocutaneous albinism II (pink-eye dilution (murine) homolog), oculocutaneous albinism II (pink-eye dilution homolog, mouse), P protein, PED, PEYCL3, Pink-eyed dilution protein homolog, SHEP1, total brown iris pigmentation

Gene Symbol

OCA2

UniProt

Q04671 (Human)

Additional OCA2 Products

Product Documents for OCA2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for OCA2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.