OR2A5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-68968

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-68968
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all OR2A5 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OR2A5 (olfactory receptor, family 2, subfamily A, member 5) The peptide sequence was selected from the C terminal of OR2A5. Peptide sequence ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OR2A5 Antibody

Western Blot: OR2A5 Antibody [NBP1-68968]

Western Blot: OR2A5 Antibody [NBP1-68968]

Western Blot: OR2A5 Antibody [NBP1-68968] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Applications for OR2A5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2A5

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Alternate Names

Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141, olfactory receptor, family 2, subfamily A, member 11 pseudogene, olfactory receptor, family 2, subfamily A, member 26, olfactory receptor, family 2, subfamily A, member 5, olfactory receptor, family 2, subfamily A, member 8, OR2A26, OR2A8, OR7-138OR2A11P, OR7-141olfactory receptor 2A5

Gene Symbol

OR2A5

UniProt

Q96R48 (Human)

Additional OR2A5 Products

Product Documents for OR2A5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for OR2A5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.