ORC4L Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56938

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56938
NBP2-56938-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all ORC4L Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ORC4L Antibody

Western Blot: ORC4L Antibody [NBP2-56938]

Western Blot: ORC4L Antibody [NBP2-56938]

Western Blot: ORC4L Antibody [NBP2-56938] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ORC4L Antibody [NBP2-56938]

Immunocytochemistry/ Immunofluorescence: ORC4L Antibody [NBP2-56938]

Immunocytochemistry/Immunofluorescence: ORC4L Antibody [NBP2-56938] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli.

Applications for ORC4L Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORC4L

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown to form a core complex with ORC2L, -3L, and -5L. Three alternatively spliced transcript variants encoding the same protein have been reported.

Alternate Names

HsORC4, ORC4LFLJ46668, Orc4p, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast)

Gene Symbol

ORC4

Additional ORC4L Products

Product Documents for ORC4L Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ORC4L Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.