ORL1/OPRL1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69143

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69143
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ORL1/OPRL1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OPRL1 (opiate receptor-like 1) The peptide sequence was selected from the middle region of OPRL1. Peptide sequence ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ORL1/OPRL1 Antibody

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml OPRL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Applications for ORL1/OPRL1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORL1/OPRL1

The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Three transcript variants encoding the same protein have been found for this gene.

Long Name

Opioid Receptor-like 1

Alternate Names

KOR-3, N/OFQ Receptor, Nociceptin Receptor, NOCIR, NOP Receptor, OOR, OPRL1, Orphanin FQ Receptor

Gene Symbol

OPRL1

UniProt

P79292 (Porcine)

Additional ORL1/OPRL1 Products

Product Documents for ORL1/OPRL1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ORL1/OPRL1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.