Skip to main content

PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54587

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-54587

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PA28 Activator gamma Subunit/PSME3. Peptide Sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24691443).

Specificity

This product is specific to Subunit or Isoform: 3.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587]

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587]

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587]

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587]

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587]

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587]

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54587] - HepG2 tissue lysate at a concentration of 0.25ug/ml.

Applications for PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PA28 Activator gamma Subunit

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

Long Name

Proteasome (Prosome, Macropain) Activator Subunit 3

Alternate Names

PSME3, REG gamma

Entrez Gene IDs

10197 (Human)

Gene Symbol

PSME3

Additional PA28 Activator gamma Subunit Products

Product Documents for PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PA28 Activator gamma Subunit/PSME3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...