PA2G4/EBP1 Antibody (9J9U5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16561

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16561-100ul
NBP3-16561-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9J9U5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PA2G4 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human PA2G4/EBP1 (NP_006182.2). ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PA2G4/EBP1 Antibody (9J9U5)

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Western Blot: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Western blot analysis of extracts of various cell lines, using PA2G4/EBP1Rabbit mAb (NBP3-16561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Immunocytochemistry/ Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Immunocytochemistry/Immunofluorescence: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunofluorescence analysis of NIH-3T3 cells using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561]

Immunohistochemistry-Paraffin: PA2G4/EBP1 Antibody (9J9U5) [NBP3-16561] - Immunohistochemistry of paraffin-embedded mouse kidney using PA2G4/EBP1Rabbit mAb (NBP3-16561) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
View 3 more images

Applications for PA2G4/EBP1 Antibody (9J9U5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PA2G4

EBP1 encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.

Long Name

Proliferation-Associated 2G4

Alternate Names

EBP1, HG4-1

Gene Symbol

PA2G4

Additional PA2G4 Products

Product Documents for PA2G4/EBP1 Antibody (9J9U5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PA2G4/EBP1 Antibody (9J9U5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.