PAK4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58833

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58833
NBP2-58833-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PAK4 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAGHSEAGGGSGDRR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAK4 Antibody

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PAK4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: PAK4 Antibody [NBP2-58833]

Immunocytochemistry/ Immunofluorescence: PAK4 Antibody [NBP2-58833]

Immunocytochemistry/Immunofluorescence: PAK4 Antibody [NBP2-58833] - Staining of human cell line MCF7 shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
View 1 more images

Applications for PAK4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAK4

p21-activated kinases (PAKs) belong to the family of serine/threonine kinases involved in the control of various cellular processes, including the cell cycle, dynamics of the cytoskeleton, apoptosis, oncogenic transformation, and transcription. All PAK family members are characterized by the presence of p21-binding domain. p21-activated kinases are regulated by the small GTP-binding proteins Rac and Cdc42, and lipids, which stimulate autophosphorylation and phosphorylation of exogenous substrates. Serine (Ser-474) is the likely autophosphorylation site in the kinase domain of PAK4 in vivo. Phosphospecific antibodies directed against serine 474 detect activated PAK4 on the Golgi membrane when PAK4 is co-expressed with activated Cdc42. Current data strongly implicates PAK-4 in oncogenesis. PAK4 is frequently overexpressed in human tumor cell lines of various tissue origins.

Long Name

p21/Cdc42/Rac1-activated Kinase 4

Alternate Names

EC 2.7.11, EC 2.7.11.1, KIAA1142, p21 protein (Cdc42/Rac)-activated kinase 4, p21(CDKN1A)-activated kinase 4, p21-activated kinase 4, PAK-4, protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs, serine/threonine-protein kinase PAK 4

Gene Symbol

PAK4

Additional PAK4 Products

Product Documents for PAK4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PAK4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.