PCBD2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85281

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85281
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PCBD2 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PCBD2 Antibody

Western Blot: PCBD2 Antibody [NBP1-85281]

Western Blot: PCBD2 Antibody [NBP1-85281]

Western Blot: PCBD2 Antibody [NBP1-85281] - Analysis in control (vector only transfected HEK293T lysate) and PCBD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PCBD2 Antibody [NBP1-85281]

Immunocytochemistry/ Immunofluorescence: PCBD2 Antibody [NBP1-85281]

Immunocytochemistry/Immunofluorescence: PCBD2 Antibody [NBP1-85281] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: PCBD2 Antibody [NBP1-85281]

Immunohistochemistry-Paraffin: PCBD2 Antibody [NBP1-85281]

Immunohistochemistry-Paraffin: PCBD2 Antibody [NBP1-85281] - Staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.

Applications for PCBD2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCBD2

PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.

Alternate Names

4-alpha-hydroxy-tetrahydropterin dehydratase 2, DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, DcoH-like protein DCoHm, dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle, dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1), Dimerization cofactor of hepatocyte nuclear factor 1 from muscle, EC 4.2.1.96, HNF-1-alpha dimerization cofactor, PHS 2, pterin-4 alpha-carbinolamine dehydratase 2, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, pterin-4-alpha-carbinolamine dehydratase 2

Gene Symbol

PCBD2

Additional PCBD2 Products

Product Documents for PCBD2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PCBD2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.