PDGFA Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05169

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-05169
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PDGF-A Antibodies »

Product Summary for PDGFA Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 21-110 of human PDGFA (NP_002598.4). EEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PDGFA Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: PDGFA Antibody - Azide and BSA Free [NBP3-05169]

Immunohistochemistry-Paraffin: PDGFA Antibody - Azide and BSA Free [NBP3-05169]

Immunohistochemistry-Paraffin: PDGFA Antibody [NBP3-05169] - Immunohistochemistry of paraffin-embedded Mouse kidney using PDGFA antibody (NBP3-05169) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: PDGFA Antibody - Azide and BSA Free [NBP3-05169]

Immunohistochemistry-Paraffin: PDGFA Antibody - Azide and BSA Free [NBP3-05169]

Immunohistochemistry-Paraffin: PDGFA Antibody [NBP3-05169] - Immunohistochemistry of paraffin-embedded Human esophagus using PDGFA antibody (NBP3-05169) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for PDGFA Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PDGF-A

Platelet-Derived Growth Factor (PDGF) is the major serum mitogen for cells of mesenchymal origin in humans. The biologically active protein is a dimer composed of two related polypeptides designated A and B. The PDGF protein has been implicated both directly as well as indirectly in several pathological states including neoplasia, arthritis, arteriosclerosis and bone marrow sclerosis. This antibody is specific for B form and reacts with PDGF(AB) and PDGF(BB) protein.

Long Name

Platelet-derived Growth Factor A

Alternate Names

PDGF-1, PDGF1PDGF A-chain, PDGF-A, Platelet-derived growth factor A chain, platelet-derived growth factor alpha chain, platelet-derived growth factor alpha isoform 2 preproprotein, platelet-derived growth factor alpha polypeptidePDGF subunit A, platelet-derived growth factor subunit A

Gene Symbol

PDGFA

Additional PDGF-A Products

Product Documents for PDGFA Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PDGFA Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.