PER3 Antibody (9I3I6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16094

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16094-100ul
NBP3-16094-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9I3I6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PER3 Antibodies »

Product Summary for PER3 Antibody (9I3I6)

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human PER3 (P56645). GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PER3 Antibody (9I3I6)

Western Blot: PER3 Antibody (9I3I6) [NBP3-16094]

Western Blot: PER3 Antibody (9I3I6) [NBP3-16094]

Western Blot: PER3 Antibody (9I3I6) [NBP3-16094] - Western blot analysis of extracts of various cell lines, using PER3 Rabbit mAb (NBP3-16094) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: PER3 Antibody (9I3I6) [NBP3-16094]

Immunocytochemistry/ Immunofluorescence: PER3 Antibody (9I3I6) [NBP3-16094]

Immunocytochemistry/Immunofluorescence: PER3 Antibody (9I3I6) [NBP3-16094] - Immunofluorescence analysis of NIH-3T3 cells using PER3 Rabbit mAb (NBP3-16094) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for PER3 Antibody (9I3I6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PER3

PER3 is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq]

Alternate Names

Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila)

Gene Symbol

PER3

Additional PER3 Products

Product Documents for PER3 Antibody (9I3I6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PER3 Antibody (9I3I6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.