Peroxiredoxin 3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38486

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38486
NBP2-38486-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Peroxiredoxin 3 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Peroxiredoxin 3 Antibody

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486]

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486]

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining in human kidney and pancreas tissues using anti-PRDX3 antibody. Corresponding PRDX3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human kidney shows high expression.
View 1 more images

Applications for Peroxiredoxin 3 Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 3

The peroxiredoxin (PRX) family comprises six antioxidant proteins, PRX I, II, III, IV, V and VI, which protect cells from reactive oxygen species (ROS) by preventing the metal-catalyzed oxidation of enzymes. The PRX proteins primarily utilize thioredoxin as the electron donor for antioxidation, although they are fairly promiscuous with regard to the hydroperoxide substrate. In addition to protection from ROS, peroxiredoxins are also involved in cell proliferation, differentiation and gene expression. PRX I, II, IV and VI show diffuse cytoplasmic localization, while PRX III and V exhibit distinct mitochondrial localization. The human PRX I gene encodes a protein that is expressed in several tissues, including liver, kidney, testis, lung and nervous system. PRX II is expressed in testis, while PRX III shows expression in lung. PRX I, II and III are overexpressed in breast cancer and may be involved in its development or progression. Upregulated protein levels of PRX I and II in Alzheimer's disease (AD) and Down syndrome (DS) indicate the involvement of PRX I and II in their pathogenesis.

Alternate Names

AOP-1, MER5, PRDX3, SP-22

Gene Symbol

PRDX3

UniProt

P30048

Additional Peroxiredoxin 3 Products

Product Documents for Peroxiredoxin 3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Peroxiredoxin 3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.