PGBD3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57117

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57117
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PGBD3 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PGBD3(piggyBac transposable element derived 3) The peptide sequence was selected from the N terminal of PGBD3. Peptide sequence AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PGBD3 Antibody

Western Blot: PGBD3 Antibody [NBP1-57117]

Western Blot: PGBD3 Antibody [NBP1-57117]

Western Blot: PGBD3 Antibody [NBP1-57117] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for PGBD3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGBD3

The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12. The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.

Alternate Names

FLJ90201, piggyBac transposable element derived 3, piggyBac transposable element-derived protein 3

Gene Symbol

PGBD3

UniProt

Q8N328 (Human)

Additional PGBD3 Products

Product Documents for PGBD3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PGBD3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.