PHAX Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48821

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48821
NBP2-48821-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PHAX Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI

Reactivity Notes

Mouse (86%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PHAX Antibody

Immunocytochemistry/ Immunofluorescence: PHAX Antibody [NBP2-48821]

Immunocytochemistry/ Immunofluorescence: PHAX Antibody [NBP2-48821]

Immunocytochemistry/Immunofluorescence: PHAX Antibody [NBP2-48821] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821]

Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821]

Immunohistochemistry-Paraffin: PHAX Antibody [NBP2-48821] - Staining in human cerebral cortex and pancreas tissues using anti-PHAX antibody. Corresponding PHAX RNA-seq data are presented for the same tissues.
Immunohistochemistry: PHAX Antibody [NBP2-48821]

Immunohistochemistry: PHAX Antibody [NBP2-48821]

Immunohistochemistry: PHAX Antibody [NBP2-48821] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.
View 2 more images

Applications for PHAX Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHAX

A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner . Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA

Alternate Names

FLJ13193, phosphorylated adapter RNA export protein, phosphorylated adaptor for RNA export, RNA U small nuclear RNA export adapter protein, RNA U, small nuclear RNA export adapter (phosphorylation regulated), RNA U, small nuclear RNA export adaptor (phosphorylation regulated), RNUXA

Gene Symbol

PHAX

Additional PHAX Products

Product Documents for PHAX Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PHAX Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.