PIGO Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-62446

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-62446
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PIGO Antibodies »

Product Summary for PIGO Antibody

Immunogen

Synthetic peptides corresponding to PIGO(phosphatidylinositol glycan anchor biosynthesis, class O) The peptide sequence was selected from the N terminal of PIGO. Peptide sequence LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PIGO Antibody

Western Blot: PIGO Antibody [NBP1-62446]

Western Blot: PIGO Antibody [NBP1-62446]

Western Blot: PIGO Antibody [NBP1-62446] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for PIGO Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGO

PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least two alternatively spliced transcripts encoding distinct isoforms have been found for this gene.

Alternate Names

class O, DKFZp434M222, EC 2.-, FLJ00135, GPI ethanolamine phosphate transferase 3, MGC20536, MGC3079, phosphatidylinositol glycan anchor biosynthesis, class O, Phosphatidylinositol-glycan biosynthesis class O protein, PIG-O, RP11-182N22.4

Gene Symbol

PIGO

UniProt

B1AML3 (Human)

Additional PIGO Products

Product Documents for PIGO Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PIGO Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.