PIST Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-55206

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-55206
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PIST Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PIST Antibody

Western Blot: PIST Antibody [NBP1-55206]

Western Blot: PIST Antibody [NBP1-55206]

Western Blot: PIST Antibody [NBP1-55206] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for PIST Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIST

GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].

Alternate Names

CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein

Gene Symbol

GOPC

Additional PIST Products

Product Documents for PIST Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PIST Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.