Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05631

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-05631
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

All Species

Applications

Dot Blot, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Poly-Ubiquitin Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human M1-linkage Specific Polyubiquitin (NP_066289.3/NP_061828.1). MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free

Western Blot: Poly-Ubiquitin AntibodyM1 LinkageAzide and BSA Free [NBP3-05631]

Western Blot: Poly-Ubiquitin AntibodyM1 LinkageAzide and BSA Free [NBP3-05631]

Western Blot: Poly-Ubiquitin Antibody - M1 Linkage [NBP3-05631] - Western blot analysis of extracts of various cell lines, using Poly-Ubiquitin antibody (NBP3-05631) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Dot Blot: Poly-Ubiquitin Antibody - M1 Linkage [NBP3-05631] - Dot-blot analysis of all sorts of peptides using Poly-Ubiquitin antibody (NBP3-05631) at 1:1000 dilution.

Applications for Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free

Application
Recommended Usage

Dot Blot

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Poly-Ubiquitin

Poly-Ubiquitin chains are composed of Ubiquitin monomers that are covalently linked through isopeptide bonds, which typically form between a lysine residue of one Ubiquitin molecule and the C-terminal glycine residue of another Ubiquitin molecule. Each human Ubiquitin monomer is 76 amino acids (aa) in length and shares 96% and 100% aa identity with yeast and mouse Ubiquitin, respectively. Seven of the 76 aa in Ubiquitin are lysine residues that can participate in poly-Ubiquitin chain formation. Linkage through specific lysine residues is thought to serve as a signal that affects protein degradation, signaling, trafficking, and other cellular processes.

Alternate Names

PolyUbiquitin

Gene Symbol

RPS27A

Additional Poly-Ubiquitin Products

Product Documents for Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Poly-Ubiquitin Antibody - M1 Linkage - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.