POU3F3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09359

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09359-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all POU3F3 Antibodies »

Product Summary for POU3F3 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat POU3F3 (NP_620192). Peptide sequence VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for POU3F3 Antibody

Western Blot: POU3F3 Antibody [NBP3-09359]

Western Blot: POU3F3 Antibody [NBP3-09359]

Western Blot: POU3F3 Antibody [NBP3-09359] - Western blot analysis of POU3F3 in Human heart. Antibody dilution at 1 ug/mL

Applications for POU3F3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU3F3

POU3F3, also known as POU Class 3 Homeobox 3, is a transcription factor that is primarily expressed in the brain and CNS. POU3F3 interacts with SOX4 and SOX11, and is implicated in the development of neurons. Current research surrounding POU3F3 has shown potential linkages with neuronitis and cerebritis. POU3F3 has also been shown to interact with POU3F4, CAV1, SOX10, and GADD34.

Alternate Names

brain-1, Brain-specific homeobox/POU domain protein 1, Brn-1, BRN1brn-1, Oct-8, Octamer-binding protein 8, Octamer-binding transcription factor 8, OTF-8, OTF8oct-8, POU class 3 homeobox 3, POU domain class 3, transcription factor 3, POU domain, class 3, transcription factor 3

Gene Symbol

POU3F3

Additional POU3F3 Products

Product Documents for POU3F3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for POU3F3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.