PPAN Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88525

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88525
NBP1-88525-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PPAN Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPAN Antibody

Western Blot: PPAN Antibody [NBP1-88525]

Western Blot: PPAN Antibody [NBP1-88525]

Western Blot: PPAN Antibody [NBP1-88525] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPAN Antibody [NBP1-88525]

Immunohistochemistry-Paraffin: PPAN Antibody [NBP1-88525]

Immunohistochemistry-Paraffin: PPAN Antibody [NBP1-88525] - Staining of human oral mucosa shows strong nucleolar positivity in squamous epithelial cells.

Applications for PPAN Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPAN

PPAN is encoded by this gene is an evolutionarily conserved protein similar to yeast SSF1 as well as to the gene product of the Drosophila gene peter pan (ppan). SSF1 is known to be involved in the second step of mRNA splicing. Both SSF1 and ppan are essential for cell growth and proliferation. This gene was found to cotranscript with P2RY11/P2Y(11), an immediate downstream gene on the chromosome that encodes a ATP receptor. The chimeric transcripts of this gene and P2RY11 were found to be ubiquitously present and regulated during granulocytic differentiation. Exogenous expression of this gene was reported to reduce the anchorage-independent growth of some tumor cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Brix domain-containing protein 3, homolog of S. cerevisiae SSF1, MGC14226, MGC45852, peter pan (Drosophila) homolog, Peter Pan homolog, peter pan homolog (Drosophila), second-step splicing factor 1, SSF, Ssf-1, SSF1BXDC3SSF-1, SSF2, suppressor of sterile four 1, suppressor of SWI4 1 homolog

Gene Symbol

PPAN

Additional PPAN Products

Product Documents for PPAN Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PPAN Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.