PPFIBP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-56315

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-56315
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all PPFIBP1 Antibodies »

Product Summary for PPFIBP1 Antibody

Immunogen

Synthetic peptides corresponding to PPFIBP1(PTPRF interacting protein, binding protein 1 (liprin beta 1)) The peptide sequence was selected from the N terminal of PPFIBP1. Peptide sequence PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PPFIBP1 Antibody

Western Blot: PPFIBP1 Antibody [NBP1-56315]

Western Blot: PPFIBP1 Antibody [NBP1-56315]

Western Blot: PPFIBP1 Antibody [NBP1-56315] - Jurkat cell lysate, concentration 2.5 ug/ml.

Applications for PPFIBP1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPFIBP1

PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Alternate Names

hSGT2liprin related protein, hSgt2p, KIAA1230, L2, liprin-beta 1, liprin-beta-1, Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 1, protein-tyrosine phosphatase receptor-type f polypeptide-interactingprotein-binding protein 1, PTPRF interacting protein, binding protein 1 (liprin beta 1), PTPRF-interacting protein-binding protein 1, SGT2

Gene Symbol

PPFIBP1

UniProt

Q86W92-5 (Human)

Additional PPFIBP1 Products

Product Documents for PPFIBP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PPFIBP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.