PRDM11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85528

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85528-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all PRDM11 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRDM11. Peptide sequence: IGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHEL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PRDM11 Antibody

Western Blot: PRDM11 Antibody [NBP2-85528]

Western Blot: PRDM11 Antibody [NBP2-85528]

Western Blot: PRDM11 Antibody [NBP2-85528] - Host: Rabbit. Target Name: PRDM11. Sample Type: 721_B Whole cell lysates. Antibody Dilution: 1.0ug/mlPRDM11 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for PRDM11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRDM11

The newly discovered family of PR domain genes is involved in tumorigenesis. Similar to acetylation and phosphorylation, histone methylation at the N-terminal tail has emerged as an important role in regulating chromatin dynamics and gene activity. Histone methylation occurs on arginine and lysine residues and is catalyzed by two families of proteins, the protein arginine methyltransferase family and the SET-domain containing methyltransferase family. Five members have been identified in the arginine methyltransferase family. About 27 are grouped into the SET-domain family, and another 17 make up the PR domain family that is related to the SET domain family. The retinoblastoma protein interacting zinc finger gene RIZ1 is a tumor suppressor gene and a FOUNDING member of the PR domain family. RIZ1 inactivation is commonly found in many types of human cancers and occurs through loss of mRNA expression, frame shift mutation, chromosomal deletion, and missense mutation.

Alternate Names

PFM8PR domain-containing protein 11, PR domain containing 11, PR-domain containing protein 11

Gene Symbol

PRDM11

Additional PRDM11 Products

Product Documents for PRDM11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PRDM11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.