PRDM8 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85533

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85533-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all PRDM8 Antibodies »

Product Summary for PRDM8 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PRDM8. Peptide sequence: PENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPYIFRVDTSAANGSSEG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PRDM8 Antibody

Western Blot: PRDM8 Antibody [NBP2-85533]

Western Blot: PRDM8 Antibody [NBP2-85533]

Western Blot: PRDM8 Antibody [NBP2-85533] - Host: Rabbit. Target Name: PRDM8. Sample Type: 293T. Antibody Dilution: 1.0ug/ml
Western Blot: PRDM8 Antibody [NBP2-85533]

Western Blot: PRDM8 Antibody [NBP2-85533]

Western Blot: PRDM8 Antibody [NBP2-85533] - WB Suggested Anti-PRDM8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: MCF7 cell lysate
Western Blot: PRDM8 Antibody [NBP2-85533]

Western Blot: PRDM8 Antibody [NBP2-85533]

Western Blot: PRDM8 Antibody [NBP2-85533] - Host: Rabbit. Target: PRDM8. Positive control (+): Human Fetal Heart (HE). Negative control (-): HeLa Cell Lysate (HL). Antibody concentration: 1ug/ml

Applications for PRDM8 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRDM8

Similar to acetylation and phosphorylation, histone methylation at the N-terminal tail has emerged as an important role in regulating chromatin dynamics and gene activity. Histone methylation occurs on arginine and lysine residues and is catalyzed by two families of proteins, the protein arginine methyltransferase family and the SET-domain-containing methyltransferase family. Five members have been identified in the arginine methyltransferase family. About 27 are grouped into the SET-domain family, and another 17 make up the PR domain family that is related to the SET domain family. The retinoblastoma protein-interacting zinc finger gene RIZ 1 is a tumor suppressor gene and a FOUNDING member of the PR domain family. RIZ 1 inactivation is commonly found in many types of human cancers and occurs through loss of mRNA expression, frame shift mutation, chromosomal deletion, and missense mutation. RIZ 1 is also a tumor susceptibility gene in mice. The loss of RIZ 1 mRNA in human cancers was shown to associate with DNA methylation of its promoter CpG island. Methylation of the RIZ 1 promoter strongly correlated with lost or decreased RIZ 1 mRNA expression in breast, liver, colon, and lung cancer cell lines as well as in liver cancer tissues.

Alternate Names

PFM5, PR domain containing 8, PR domain zinc finger protein 8, PR domain-containing protein 8, PR-domain containing protein 8

Gene Symbol

PRDM8

Additional PRDM8 Products

Product Documents for PRDM8 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PRDM8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.