Prohibitin 2 Antibody (8I10B1)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16766

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16766-100ul
NBP3-16766-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8I10B1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Prohibitin 2 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2) (Q99623). QMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Prohibitin 2 Antibody (8I10B1)

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Western blot analysis of extracts of various cell lines, using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunofluorescence analysis of U-2 OS cells using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766]

Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
View 2 more images

Applications for Prohibitin 2 Antibody (8I10B1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:3000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Prohibitin 2

REA, or repressor of estrogen receptor activity, (also known as BAP37, or B-cell receptor-associated protein) is a 37 kD erythrocyte band 7 integral membrane protein that contains an SPFH domain. It is located in the inner mitochondrial membrane that selectively potentiates the inhibitory effectiveness of antiestrogen-occupied ER. REA plays a possible role in cell aging and acts as a mitochondrial protein chaperone. This protein has been shown to interact with the estrogen receptor, prohibitin, and IgM.

Alternate Names

BAP, Bap37, BCAP37, D-Prohibitin, p22, PHB2, PNAS-141, REA

Gene Symbol

PHB2

Additional Prohibitin 2 Products

Product Documents for Prohibitin 2 Antibody (8I10B1)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Prohibitin 2 Antibody (8I10B1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.