Proteasome 19S S7 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87797

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87797
NBP1-87797-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Proteasome 19S S7 Antibodies »

Product Summary for Proteasome 19S S7 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Proteasome 19S S7 Antibody

Western Blot: Proteasome 19S S7 Antibody [NBP1-87797]

Western Blot: Proteasome 19S S7 Antibody [NBP1-87797]

Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797]

Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797]

Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Simple Western: Proteasome 19S S7 Antibody [NBP1-87797]

Simple Western: Proteasome 19S S7 Antibody [NBP1-87797]

Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is beginning at 0.5 mg/mL. Simple Western image submitted by a verified customer review.
View 1 more images

Applications for Proteasome 19S S7 Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-87797 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 19S S7

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This subunit may also compete with PSMC3 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex.

Alternate Names

26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, MGC3004, MSS1ATPase, 2, proteasome (prosome, macropain) 26S subunit, ATPase, 2, Protein MSS1, putative protein product of Nbla10058

Gene Symbol

PSMC2

Additional Proteasome 19S S7 Products

Product Documents for Proteasome 19S S7 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Proteasome 19S S7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.