Proteasome 20S alpha 5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86838

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86838
NBP1-86838-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Proteasome 20S alpha 5 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Proteasome 20S alpha 5 Antibody

Western Blot: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Western Blot: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Western Blot: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunocytochemistry/Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838]

Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-86838] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in seminiferous duct cells.

Applications for Proteasome 20S alpha 5 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S alpha 5

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman's syndrome, and Liddle syndrome.

Long Name

Proteasome subunit alpha type-5

Alternate Names

PSMA5

Gene Symbol

PSMA5

Additional Proteasome 20S alpha 5 Products

Product Documents for Proteasome 20S alpha 5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Proteasome 20S alpha 5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.