Proteasome beta 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89713

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89713
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Proteasome beta 1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Proteasome beta 1 Antibody

Western Blot: Proteasome beta 1 Antibody [NBP1-89713]

Western Blot: Proteasome beta 1 Antibody [NBP1-89713]

Western Blot: Proteasome beta 1 Antibody [NBP1-89713] - Analysis using Anti-PSMB1 antibody NBP1-89713 (A) shows similar pattern to independent antibody NBP1-89714 (B).
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713]

Immunohistochemistry-Paraffin: Proteasome beta 1 Antibody [NBP1-89713] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
View 3 more images

Applications for Proteasome beta 1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome beta 1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species. [provided by RefSeq]

Long Name

Proteasome subunit beta type-1

Alternate Names

PSC5, PSMB1

Entrez Gene IDs

5689 (Human)

Gene Symbol

PSMB1

UniProt

P20618 (Human)

Additional Proteasome beta 1 Products

Product Documents for Proteasome beta 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Proteasome beta 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.