PSMB10/MECL1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88660

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88660
NBP1-88660-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PSMB10/MECL1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMB10/MECL1 Antibody

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660] - Analysis in human tonsil and skeletal muscle tissues using NBP1-88660 antibody. Corresponding PSMB10 RNA-seq data are presented for the same tissues.
Western Blot: PSMB10/MECL1 Antibody [NBP1-88660]

Western Blot: PSMB10/MECL1 Antibody [NBP1-88660]

Western Blot: PSMB10/MECL1 Antibody [NBP1-88660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-450
Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660]

Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660]

Immunocytochemistry/Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
View 2 more images

Applications for PSMB10/MECL1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMB10/MECL1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 10

Alternate Names

LMP10, MECl-1, MECL1, Proteasome subunit beta-2i

Gene Symbol

PSMB10

Additional PSMB10/MECL1 Products

Product Documents for PSMB10/MECL1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PSMB10/MECL1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.