Purine Nucleoside Phosphorylase/PNP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54353

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54353
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Purine Nucleoside Phosphorylase/PNP Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NP(nucleoside phosphorylase) The peptide sequence was selected from the middle region of NP. Peptide sequence GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Purine Nucleoside Phosphorylase/PNP Antibody

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
View 1 more images

Applications for Purine Nucleoside Phosphorylase/PNP Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Purine Nucleoside Phosphorylase/PNP

Defects in NP are the cause of nucleoside phosphorylase deficiency (NP deficiency). It leads to a severe T-cell immunodeficiency with neurologic disorder in children. The specific function of NP is not yet known.This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Inosine phosphorylase, PUNP

Gene Symbol

PNP

UniProt

P00491

Additional Purine Nucleoside Phosphorylase/PNP Products

Product Documents for Purine Nucleoside Phosphorylase/PNP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Purine Nucleoside Phosphorylase/PNP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.