RANBP9 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85595

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85595-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RANBP9 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RANBP9. Peptide sequence: SHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RANBP9 Antibody

Western Blot: RANBP9 Antibody [NBP2-85595]

Western Blot: RANBP9 Antibody [NBP2-85595]

Western Blot: RANBP9 Antibody [NBP2-85595] - Host: Rabbit. Target Name: RANBP9. Sample Tissue: Human Thyroid Tumor lysates. Antibody Dilution: 1ug/ml

Applications for RANBP9 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RANBP9

Just as heat shock proteins function as chaperones for exposed hydrophobic patches, importins act as chaperones for exposed basic domains, and it is suggested that this represents a major and general cellular function of importins (1). RanBP9, a novel interacting protein, was localized within the centrosome throughout the cell cycle. Overexpression of RanBP9 produced multiple spots which were colocalized with gamma-tubulin and acted as ectopic microtubule nucleation sites, resulting in a reorganization of microtubule network (2). It has been shown that RanBP9 can induce GTP-Ras association and Erk phosphorylation and elevate serum response element-luciferase (SRE-LUC) expression, indicating that RanBP9 can activate the Ras-Erk-SRE pathway. Also RanBP9 stimulates Ras activation by recruiting Sos (3).

Alternate Names

BPM90, BPM-L, RAN binding protein 9, Ran Binding Protein in the Microtubule organizing center, ran binding protein, centrosomal, ran-binding protein 9, Ran-binding protein M, RanBP7, RanBP9, RanBPM, RANBPMnovel centrosomal protein RanBPM

Gene Symbol

RANBP9

Additional RANBP9 Products

Product Documents for RANBP9 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RANBP9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.