RCAN2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09305

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09305-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RCAN2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of HUMAN RCAN2. Peptide sequence VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RCAN2 Antibody

Western Blot: RCAN2 Antibody [NBP3-09305]

Western Blot: RCAN2 Antibody [NBP3-09305]

Western Blot: RCAN2 Antibody [NBP3-09305] - Western blot analysis of RCAN2 in COLO205 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for RCAN2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RCAN2

Calcipressin-2, also known as RCAN2, plays a key role in many physiological procedures. Expressed in fibroblasts, heart, brain, liver, and skeletal muscle, RCAN2 prevents calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Translocation of the transcription factor NFATC1 can also be attributed to the binding of calcineurin A. Further research indicates that RCAN could also play a role in endothelial cell function, angiogenesis and central nervous system development.

Alternate Names

Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2), calcipressin-2, Down syndrome candidate region 1-like 1, Down syndrome critical region gene 1-like 1, DSCR1L1MCIP2ZAKI4RCN2, hRCN2, Myocyte-enriched calcineurin-interacting protein 2, regulator of calcineurin 2CSP2, thyroid hormone-responsive (skin fibroblasts), Thyroid hormone-responsive protein ZAKI-4, ZAKI-4

Gene Symbol

RCAN2

Additional RCAN2 Products

Product Documents for RCAN2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RCAN2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.