RED1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86772

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86772
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

View all RED1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human RED1. Peptide sequence: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RED1 Antibody

Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772] - WB Suggested Anti-ADARB1 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate
Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772] - ADARB1 antibody - N-terminal region validated by WB using Mouse brains at 1:1000.

Applications for RED1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RED1

RED1 encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq]

Alternate Names

ADAR2a, ADAR2ADAR2g, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, adenosine deaminase, RNA-specific, B1, double-stranded RNA-specific editase 1, DRABA2, DRADA2hRED1, EC 3.5, human dsRNA adenosine deaminase DRADA2, human dsRNA adenosine deaminase DRADA2b, EC 3.510adenosine deaminase, RNA-specific, B1 (homolog of rat RED1), RED1 homolog, RED1ADAR2d, RNA editase, RNA editing deaminase 1, RNA-editing deaminase 1, RNA-editing enzyme 1, RNA-specific, B1 (RED1 homolog rat)

Gene Symbol

ADARB1

Additional RED1 Products

Product Documents for RED1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RED1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.