Skip to main content

Rev-erb beta/NR1D2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56141

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56141

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSP

Reactivity Notes

Mouse 85%.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rev-erb beta/NR1D2 Antibody

Western Blot: Rev-erb beta/NR1D2 Antibody [NBP2-56141]

Western Blot: Rev-erb beta/NR1D2 Antibody [NBP2-56141]

Western Blot: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141]

Immunocytochemistry/ Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141]

Immunocytochemistry/Immunofluorescence: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Staining of human cell line PC-3 shows localization to nucleoplasm.
Rev-erb beta/NR1D2 Antibody

Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-56141] -

Immunohistochemistry: Rev-erb beta/NR1D2 Antibody [NBP2-56141] - Cancer cells from small cell carcinoma employ highly divergent regulatory program compared to adenocarcinoma cells.a,b, Gene set expression scores of single G1 cells using expression signature of NEPC18 (a) & set of genes regulated by AR17 (b). Box plots: center line, median; box limits, upper & lower quartiles; whiskers extend at most 1.5× interquartile range past upper & lower quartiles; P values from 2-sided Mann–Whitney U-test. c, Inferred activity of regulons of different transcriptional regulators. x axis, q values from comparison of inferred regulon activity in cancer cells from small cell carcinoma (n = 76) vs cancer cells from adenocarcinomas (n = 188, sampled as described in Methods) (negative values indicate regulon is less active in small cell carcinoma; two-sided Mann–Whitney U-test, median outcome of sampling iterations (Methods) w/ Bonferroni FWER correction). y axis: P values (two-sided Mann–Whitney U-test, signed as previous) from comparison of expression scores of scRNA-derived regulons in bulk RNA-seq of small cell carcinomas (n = 8) vs adenocarcinomas (n = 18) from a published cohort8. d, Regulon activity in single cells for select transcriptional regulators. e, Hierarchical clustering of bulk RNA-seq of a published cohort of prostate cancers of known histopathology18 based on expression of HOXB5, HOXB6 & NR1D2 regulons inferred from scRNA-seq. B–E correspond to different NEPC subtype labels from original publication. Expression levels of EZH2, NANOG & SOX2 shown for reference but not used in clustering (n = 34 adenocarcinoma, 15 NEPC). f, IHC staining of HOXB5, HOXB6 & NR1D2 protein levels in two prostate adenocarcinoma xenografts (LNCaP & VCaP) & four NEPC patient-derived organoids. Scale bar: 50 μm. Image collected & cropped by CiteAb from following publication (https://pubmed.ncbi.nlm.nih.gov/33664492), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Rev-erb beta/NR1D2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rev-erb beta/NR1D2

The NR1D2 gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Al

Alternate Names

BD73, EAR-1R, NR1D2, Reverb beta

Gene Symbol

NR1D2

Additional Rev-erb beta/NR1D2 Products

Product Documents for Rev-erb beta/NR1D2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Rev-erb beta/NR1D2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...