Rffl Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83427

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83427
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Rffl Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rffl Antibody

Western Blot: Rffl Antibody [NBP1-83427]

Western Blot: Rffl Antibody [NBP1-83427]

Western Blot: Rffl Antibody [NBP1-83427] - Analysis in control (vector only transfected HEK293T lysate) and RFFL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Rffl Antibody [NBP1-83427]

Immunohistochemistry-Paraffin: Rffl Antibody [NBP1-83427]

Immunohistochemistry-Paraffin: Rffl Antibody [NBP1-83427] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.

Applications for Rffl Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rffl

RFFL, also known as Rififylin, RING finger and FYVE-like domain-containing protein 1, FYVE-RING finger protein, Sakura, Fring, Caspases-8 and -10-associated RING finger protein 2, CARP-2, Caspase regulator CARP2, RING finger protein 189 and RING finger protein 34-like, is a novel modulator of NF-kB activation. RFFL possesses E3 ubiquitin protein ligase activity and has been shown to regulate the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL also possesses anti-apoptotic activity and may bind phosphatidylinositol phosphates. RFFL is a membrane bound cytoplasmic protein that is expressed ubiquitously. RFFL can be detected in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes and is rapidly degraded after stimulation with TNFSF10, and probably by caspases. Multiple transcript variants have been detected for this protein.

Alternate Names

CARP-2, Caspase regulator CARP2, Caspases-8 and -10-associated RING finger protein 2, E3 ubiquitin-protein ligase rififylin, EC 6.3.2, EC 6.3.2.-, Fring, FYVE-RING finger protein Sakura, rififylin, ring finger and FYVE-like domain containing 1, RING finger and FYVE-like domain-containing protein 1, RING finger protein 189, RING finger protein 34-like, RNF189CARP2, RNF34LFRING

Gene Symbol

RFFL

Additional Rffl Products

Product Documents for Rffl Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Rffl Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.