RFXAP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58217

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58217
NBP2-58217-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all RFXAP Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RFXAP Antibody

Immunocytochemistry/ Immunofluorescence: RFXAP Antibody [NBP2-58217]

Immunocytochemistry/ Immunofluorescence: RFXAP Antibody [NBP2-58217]

Immunocytochemistry/Immunofluorescence: RFXAP Antibody [NBP2-58217] - Staining of human cell line HEK 293 shows localization to nuclear speckles.

Applications for RFXAP Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFXAP

The identification of transacting factors controlling major histocompatibility complex (MHC) class II gene transcription via the proximal enhancer of the promoter has been greatly facilitated by a genetic approach, namely, the analysis of cell lines that are characterized by regulatory defects abolishing transcription of these genes (Mach et al., 1996). Most of these MHC class II regulatory mutants are cell lines derived from patients suffering from MHC class II deficiency, also referred to as the bare lymphocyte syndrome type II, a rare autosomal recessive disorder characterized by the lack of constitutive and inducible MHC class II expression in all cell types and tissues. The genetic lesions responsible for this lack of expression lie not in MHC class II genes themselves, but in transacting regulatory genes required for their transcription (Mach et al., 1996). Durand et al. (1997) noted that at least 3 different complementation groups (groups A, B, and C) have been identified by means of somatic cell fusion experiments. the defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC class II promoters Durand et al. (1997) isolated a novel gene that encodes the 36-kD subunit of RFX. They called this subunit RFX-associated protein (RFXAP) because it is a subunit of the RFX complex and interacts with RFX5, yet it does not contain the characteristic RFX DNA-binding motif.

Alternate Names

regulatory factor X-associated protein, RFX DNA-binding complex 36 kDa subunit, RFX-associated protein

Gene Symbol

RFXAP

Additional RFXAP Products

Product Documents for RFXAP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RFXAP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.