RGS2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10554

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10554-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RGS2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_033087). Peptide sequence NSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RGS2 Antibody

Immunohistochemistry: RGS2 Antibody [NBP3-10554]

Immunohistochemistry: RGS2 Antibody [NBP3-10554]

Immunohistochemistry: RGS2 Antibody [NBP3-10554] - Immunohistochemical analysis of spleen.

Applications for RGS2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS2

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis. (provided by RefSeq)

Alternate Names

Cell growth-inhibiting gene 31 protein, G0 to G1 switch regulatory 8, 24kD, G0/G1 switch regulatory protein 8, G0S8cell growth-inhibiting protein 31, regulator of G-protein signaling 2, regulator of G-protein signaling 2, 24kDa, regulator of G-protein signalling 2, 24kD, regulator of G-protein signalling 2, 24kDa

Gene Symbol

RGS2

Additional RGS2 Products

Product Documents for RGS2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RGS2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.