RHBG Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69483

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69483
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all RHBG Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RHBG(Rh family, B glycoprotein) The peptide sequence was selected from the C terminal of RHBG. Peptide sequence LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RHBG Antibody

Western Blot: RHBG Antibody [NBP1-69483]

Western Blot: RHBG Antibody [NBP1-69483]

Western Blot: RHBG Antibody [NBP1-69483] - This Anti-RHBG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: RHBG Antibody [NBP1-69483]

Immunohistochemistry: RHBG Antibody [NBP1-69483]

Immunohistochemistry: RHBG Antibody [NBP1-69483] - Staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. RHBG Antibody concentration 5 ug/ml.

Applications for RHBG Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHBG

RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1309 AF193807.1 1-1309 1310-1310 AL139130.28 4265-4265 1311-1806 AF193807.1 1310-1805

Alternate Names

ammonium transporter Rh type B, Rh family type B glycoprotein, Rh family, B glycoprotein (gene/pseudogene), Rh type B glycoprotein, Rhesus blood group family type B glycoprotein, Rhesus blood group, B glycoprotein, SLC42A2

Gene Symbol

RHBG

UniProt

Q9H310 (Human)

Additional RHBG Products

Product Documents for RHBG Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RHBG Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.