Ribosomal Protein L24 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33622

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33622
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Ribosomal Protein L24 Antibodies »

Product Summary for Ribosomal Protein L24 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ribosomal Protein L24 Antibody

Western Blot: Ribosomal Protein L24 Antibody [NBP2-33622]

Western Blot: Ribosomal Protein L24 Antibody [NBP2-33622]

Western Blot: Ribosomal Protein L24 Antibody [NBP2-33622] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line SK-MEL-30
Immunocytochemistry/ Immunofluorescence: Ribosomal Protein L24 Antibody [NBP2-33622]

Immunocytochemistry/ Immunofluorescence: Ribosomal Protein L24 Antibody [NBP2-33622]

Immunocytochemistry/Immunofluorescence: Ribosomal Protein L24 Antibody [NBP2-33622] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry: Ribosomal Protein L24 Antibody [NBP2-33622]

Immunohistochemistry: Ribosomal Protein L24 Antibody [NBP2-33622]

Immunohistochemistry: Ribosomal Protein L24 Antibody [NBP2-33622] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Applications for Ribosomal Protein L24 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ribosomal Protein L24

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24E family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as ribosomal protein L30 because the encoded protein shares amino acid identity with the L30 ribosomal proteins from S. cerevisiae; however, its official name is ribosomal protein L24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Alternate Names

60S ribosomal protein L24, 60S ribosomal protein L30, L24, ribosomal protein L30, RPL24

Gene Symbol

RPL24

UniProt

P83731 (Human)

Additional Ribosomal Protein L24 Products

Product Documents for Ribosomal Protein L24 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Ribosomal Protein L24 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.